PDB entry 4b3w

View 4b3w on RCSB PDB site
Description: Crystal structure of human cytoglobin H(E7)Q mutant
Class: oxygen transport
Keywords: oxygen transport, metal binding protein, heme hexacoordination, protein cavity
Deposited on 2012-07-26, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21371
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WWM9
      • engineered mutation (37)
      • engineered mutation (80)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d4b3wa_
  • Chain 'B':
    Compound: cytoglobin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WWM9
      • engineered mutation (37)
      • engineered mutation (80)
      • engineered mutation (82)
    Domains in SCOPe 2.07: d4b3wb_
  • Heterogens: HEM, CYN, FC6, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b3wA (A:)
    mekvpgemeierrerseelseaerkavqamwarlyansedvgvailvrffvnfpsakqyf
    sqfkhmedplemerspqlrkqasrvmgalntvvenlhdpdkvssvlalvgkahalkhkve
    pvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnatt
    ppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b3wA (A:)
    elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkqasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b3wB (B:)
    mekvpgemeierrerseelseaerkavqamwarlyansedvgvailvrffvnfpsakqyf
    sqfkhmedplemerspqlrkqasrvmgalntvvenlhdpdkvssvlalvgkahalkhkve
    pvyfkilsgvilevvaeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnatt
    ppatlpssgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b3wB (B:)
    elseaerkavqamwarlyansedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
    lrkqasrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
    efasdfppetqrawaklrgliyshvtaaykevgw