PDB entry 4b3a

View 4b3a on RCSB PDB site
Description: Tetracycline repressor class D mutant H100A in complex with tetracycline
Class: transcription
Keywords: transcription, tet-repressor
Deposited on 2012-07-23, released 2013-06-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-06-12, with a file datestamp of 2013-06-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.2054
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (0-206)
      • cloning artifact (0)
      • engineered mutation (98)
    Domains in SCOPe 2.04: d4b3aa1, d4b3aa2
  • Heterogens: TAC, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b3aA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b3aA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltnlppllrealqimdsddgeqaflhg
    leslirgfevqltallqiv