PDB entry 4b36

View 4b36 on RCSB PDB site
Description: Crystal Structure of Human Angiogenin with an Engineered Loop Exhibits Conformational Flexibility at the Functional Regions of the Molecule
Class: hydrolase
Keywords: hydrolase, edn, ang, antiviral, angiogenesis, tumor, amyotrophic lateral sclerosis, parkinsons disease
Deposited on 2012-07-20, released 2012-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.2389
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin, eosinophil cationic-related protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b36a_
  • Chain 'B':
    Compound: angiogenin, eosinophil cationic-related protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4b36b_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b36A (A:)
    mqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicen
    kngnphrenlriskssfqvttcklttpspqnisncqyratagfrnvvvacenglpvhldq
    sifrrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b36A (A:)
    nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicnphre
    nlriskssfqvttcklttpspqnisncqyratagfrnvvvacenglpvhldqsifr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b36B (B:)
    mqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicen
    kngnphrenlriskssfqvttcklttpspqnisncqyratagfrnvvvacenglpvhldq
    sifrrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b36B (B:)
    srythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenphre
    nlriskssfqvttcklttpsncqyratagfrnvvvacenglpvhldqsifrrp