PDB entry 4b30

View 4b30 on RCSB PDB site
Description: Structure of the mutant V44A of the fluorescent protein KillerRed
Class: fluorescent protein
Keywords: fluorescent protein, photobleaching, photoconversion, ros
Deposited on 2012-07-19, released 2013-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.16715
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KillerRed
    Species: Anthomedusae sp. DC-2005 [TaxId:328397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2TCH5
      • engineered mutation (43)
      • chromophore (64)
    Domains in SCOPe 2.07: d4b30a_
  • Chain 'B':
    Compound: KillerRed
    Species: Anthomedusae sp. DC-2005 [TaxId:328397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2TCH5
      • engineered mutation (43)
      • chromophore (64)
    Domains in SCOPe 2.07: d4b30b_
  • Heterogens: SO4, CL, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b30A (A:)
    meggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnahavcetgklpmswkpi
    chliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsr
    itvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdsk
    mtfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaigsded
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b30A (A:)
    eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnahavcetgklpmswkpic
    hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
    tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
    tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvprits
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b30B (B:)
    meggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnahavcetgklpmswkpi
    chliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsr
    itvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdsk
    mtfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaigsded
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b30B (B:)
    eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnahavcetgklpmswkpic
    hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
    tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
    tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsai