PDB entry 4b2c

View 4b2c on RCSB PDB site
Description: Structure of the factor Xa-like trypsin variant triple-Ala (TPA) in complex with eglin C
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on 2012-07-13, released 2012-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: 0.15805
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (204)
    Domains in SCOPe 2.06: d4b2ca_
  • Chain 'B':
    Compound: eglin c
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01051 (1-70)
      • expression tag (0)
      • engineered mutation (45)
    Domains in SCOPe 2.06: d4b2cb1, d4b2cb2
  • Chain 'C':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (204)
    Domains in SCOPe 2.06: d4b2cc_
  • Chain 'D':
    Compound: eglin c
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01051 (1-70)
      • expression tag (0)
      • engineered mutation (45)
    Domains in SCOPe 2.06: d4b2cd1, d4b2cd2
  • Heterogens: CA, GOL, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b2cA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp
    vvcsgklqgivswgsgcaqknkpgfytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b2cB (B:)
    gtefgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpg
    tnvvnhvphvg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b2cC (C:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp
    vvcsgklqgivswgsgcaqknkpgfytkvcnyvswikqtiasn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b2cD (D:)
    gtefgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpg
    tnvvnhvphvg