PDB entry 4b2a

View 4b2a on RCSB PDB site
Description: Structure of the factor Xa-like trypsin variant triple-Ala (TGA) in complex with eglin C
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on 2012-07-13, released 2012-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.2045
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d4b2aa_
  • Chain 'B':
    Compound: eglin c
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01051 (0-65)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d4b2ab_
  • Chain 'C':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d4b2ac_
  • Chain 'D':
    Compound: eglin c
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01051 (0-65)
      • engineered mutation (40)
    Domains in SCOPe 2.07: d4b2ad_
  • Heterogens: CA, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b2aA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp
    vvcsgklqgivswgegcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b2aB (B:)
    selksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtnvvn
    hvphvg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b2aC (C:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp
    vvcsgklqgivswgegcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b2aD (D:)
    selksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtnvvn
    hvphvg