PDB entry 4b1t

View 4b1t on RCSB PDB site
Description: Structure of the factor Xa-like trypsin variant triple-Ala (TA) in complex with eglin C
Class: hydrolase/hydrolase inhibitor
Keywords: hydrolase-hydrolase inhibitor complex
Deposited on 2012-07-12, released 2012-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.18453
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (171)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d4b1ta_
  • Chain 'B':
    Compound: eglin c
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01051 (Start-69)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d4b1tb_
  • Chain 'C':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered mutation (78)
      • engineered mutation (80)
      • engineered mutation (151-154)
      • engineered mutation (171)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d4b1tc_
  • Chain 'D':
    Compound: eglin c
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01051 (Start-69)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d4b1td_
  • Heterogens: CA, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b1tA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b1tB (B:)
    tefgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgt
    nvvnhvphvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b1tB (B:)
    efgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtn
    vvnhvphvg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b1tC (C:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdaggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4b1tD (D:)
    tefgselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgt
    nvvnhvphvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b1tD (D:)
    gselksfpevvgktvdqareyftlhypqydvyflpegspvtkdlrynrvrvfynpgtnvv
    nhvphvg