PDB entry 4b1r

View 4b1r on RCSB PDB site
Description: Tetracycline repressor class D mutant H100A in complex with iso-7- Chlortetracycline
Class: transcription
Keywords: transcription, iso-tetracycline
Deposited on 2012-07-12, released 2013-07-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.20833
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetracycline repressor protein class d
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACT4 (1-206)
      • cloning artifact (0)
      • engineered mutation (98)
    Domains in SCOPe 2.03: d4b1ra1, d4b1ra2
  • Heterogens: ITC, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b1rA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsdd
    geqaflhgleslirgfevqltallqiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b1rA (A:)
    srlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
    rhhdyslpaageswqsflrnnamsfrrallryrdgakvalgtrpdekqydtvetqlrfmt
    engfslrdglyaisavshftlgavleqqehtaaltlppllrealqimdsddgeqaflhgl
    eslirgfevqltallqiv