PDB entry 4b1c

View 4b1c on RCSB PDB site
Description: New Aminoimidazoles as BACE-1 Inhibitors: From Rational Design to Ab- lowering in Brain
Class: hydrolase
Keywords: hydrolase, lead generation, structure-based drug design, inhibitor
Deposited on 2012-07-10, released 2012-10-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.19093
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56817 (6-373)
      • conflict (0-1)
    Domains in SCOPe 2.03: d4b1ca_
  • Heterogens: DMS, 1B1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4b1cA (A:)
    kkgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqr
    qlsstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsn
    wegilglayaeiarpddslepffdslvkqthvpnlfslqlcgggsmiiggidhslytgsl
    wytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksi
    kaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrp
    vedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrta
    avegpfvtledcgyn