PDB entry 4b0m

View 4b0m on RCSB PDB site
Description: Complex of the Caf1AN usher domain, Caf1M chaperone and Caf1 subunit from Yersinia pestis
Class: protein transport
Keywords: protein transport, chaperone-usher pathway, pili assembly
Deposited on 2012-07-03, released 2012-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F1 capsule-anchoring protein
    Species: Yersinia pestis [TaxId:632]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4b0ma_
  • Chain 'B':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4b0mb_
  • Chain 'M':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4b0mm1, d4b0mm2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b0mA (A:)
    aytfdstmldtnsgesidvslfnqglqlpgnyfvnvfvngrkvdsgnidfrlekhngkel
    lwpclsslqltkygididkypdliksgteqcvdllaiphsdvqfyfnqqklslivppqal
    lprfdgimpmqlwddg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b0mA (A:)
    aytfdstmldtnsgesidvslfnqglqlpgnyfvnvfvngrkvdsgnidfrlekhngkel
    lwpclsslqltkygididkypdlieqcvdllaiphsdvqfyfnqqklslivppqallprf
    dgimpmqlwdd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4b0mB (B:)
    adltasttatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
    nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
    ffvrsigskggklaagkytdavtvtvsnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b0mB (B:)
    eparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltf
    tsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkla
    agkytdavtvtvsnq
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4b0mM (M:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvddatnkqkf
    npdkdvgvfvqfainncikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnig
    eltfggksipshyippkstwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b0mM (M:)
    dikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekedpfvvtp
    plfrldakqqnslriaqaggvfprdkeslkwlcvkgippkddkdvgvfvqfainncikll
    vrpnelkgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwa
    fdlpkglagnvswriindqggldrlysknvtl