PDB entry 4b0m

View 4b0m on RCSB PDB site
Description: Complex of the Caf1AN usher domain, Caf1M chaperone and Caf1 subunit from Yersinia pestis
Class: protein transport
Keywords: protein transport, chaperone-usher pathway, pili assembly
Deposited on 2012-07-03, released 2012-09-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: F1 capsule-anchoring protein
  Species: Yersinia pestis [TaxId:632]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26949 (0-End)
• Chain 'B':
  Compound: F1 capsule antigen
  Species: Yersinia pestis [TaxId:632]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26948 (Start-148)
  Domains in SCOPe 2.02: d4b0mb_
• Chain 'M':
  Compound: Chaperone protein Caf1M
  Species: Yersinia pestis [TaxId:632]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26926 (Start-234)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4b0mB (B:)
  adltasttatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
  nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
  ffvrsigskggklaagkytdavtvtvsnq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4b0mB (B:)
  eparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltf
  tsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkla
  agkytdavtvtvsnq
  

  
  
• Chain 'M':
  No sequence available.