PDB entry 4b0g

View 4b0g on RCSB PDB site
Description: Complex of Aurora-A bound to an Imidazopyridine-based inhibitor
Class: transferase
Keywords: transferase, mitosis
Deposited on 2012-07-02, released 2013-03-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-13, with a file datestamp of 2013-03-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4b0ga_
  • Heterogens: VEK, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4b0gA (A:)
    meskkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrr
    eveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitel
    analsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppem
    iegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardli
    srllkhnpsqrpmlrevlehpwitansskpsncqnkesaskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4b0gA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlvehqlrreveiqshlr
    hpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanalsychs
    krvihrdikpenlllgsagelkiadfgwsvtldylppemiehdekvdlwslgvlcyeflv
    gkppfeantyqetykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwit
    ansskps