PDB entry 4ayn

View 4ayn on RCSB PDB site
Description: Structure of the C-terminal barrel of Neisseria meningitidis FHbp Variant 2
Class: immune system
Keywords: immune system, antigens, complement factor h, vaccines
Deposited on 2012-06-21, released 2012-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor h-binding protein
    Species: Neisseria meningitidis MC58 [TaxId:122586]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6KHT4 (Start-258)
      • expression tag (259-263)
      • conflict (150)
    Domains in SCOPe 2.07: d4ayna1, d4ayna2
  • Chain 'B':
    Compound: factor h-binding protein
    Species: Neisseria meningitidis MC58 [TaxId:122586]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6KHT4 (Start-258)
      • conflict (150)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aynA (A:)
    mgpdsdrlqqrrvaadigagladaltapldhkdkslqsltldqsvrkneklklaaqgaek
    tygngdslntgklkndkvsrfdfirqievdgqlitlesgefqiykqdhsavvalqiekin
    npdkidslinqrsflvsglggehtafnqlpsgkaeyhgkafssddpngrlhysidftkkq
    gygriehlktpeqnvelasaelkadekshavilgdtrygseekgtyhlalfgdraqeiag
    satvkirekvheigiagkqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aynA (A:)
    ggehtafnqlpsgkaeyhgkafssddpngrlhysidftkkqgygriehlktpeqnvelas
    aelkadekshavilgdtrygseekgtyhlalfgdraqeiagsatvkirekvheigiagkq
    lehhh
    

  • Chain 'B':
    No sequence available.