PDB entry 4ayk

View 4ayk on RCSB PDB site
Description: catalytic fragment of human fibroblast collagenase complexed with cgs- 27023a, nmr, 30 structures
Deposited on 1999-02-01, released 1999-06-05
The last revision prior to the SCOP 1.59 freeze date was dated 1999-06-05, with a file datestamp of 1999-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d4ayka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aykA (A:)
    vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim
    isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel
    ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp