PDB entry 4ayk

View 4ayk on RCSB PDB site
Description: catalytic fragment of human fibroblast collagenase complexed with cgs-27023a, nmr, 30 structures
Class: matrix metalloproteinase
Keywords: matrix metalloproteinase, hydrolase, metalloprotease, glycoprotein
Deposited on 1999-02-01, released 1999-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (collagenase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ayka_
  • Heterogens: ZN, CA, CGS

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aykA (A:)
    vltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadim
    isfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahel
    ghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp