PDB entry 4ayf

View 4ayf on RCSB PDB site
Description: Crystal structure of the complex of the Caf1M:Caf1 chaperone:subunit preassembly complex carrying the Tyr40Ala mutation in the Caf1M chaperone
Class: chaperone/antigen
Keywords: chaperone-antigen complex, antigens, fimbriae, molecular chaperones, protein folding,
Deposited on 2012-06-20, released 2012-09-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.1951
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26926
      • engineered mutation (39)
  • Chain 'B':
    Compound: F1 capsule antigen
    Species: Yersinia pestis [TaxId:632]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4ayfb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4ayfB (B:)
adltasttatatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
ffvrsigskggklaagkytdavtvtvsnq

    Sequence, based on observed residues (ATOM records): (download) 
    >4ayfB (B:)
veparitltykegapitiidtellvgtltlggykttstsvnftdaagdpmyltftsqdgn
nhqfttkvigkfdispkvngenlvdvvlatgsqdffvrsigskgglaagkytdavtvtvs
nq