PDB entry 4ay0

View 4ay0 on RCSB PDB site
Description: High resolution crystal structure of the monomeric subunit-free Caf1M chaperone
Class: chaperone
Keywords: chaperone, amino acid motifs, bacterial capsules, bacterial proteins, gene expression regulation, molecular chaperones, protein binding, protein conformation
Deposited on 2012-06-16, released 2012-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-21, with a file datestamp of 2012-11-16.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.1668
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ay0a1, d4ay0a2
  • Chain 'B':
    Compound: Chaperone protein Caf1M
    Species: Yersinia pestis [TaxId:632]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ay0b1, d4ay0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ay0A (A:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvdvqfainnc
    ikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippk
    stwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ay0A (A:)
    gvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplfrlda
    kqqnslriaqaggvfprdkeslkwlcvkgippncikllvrpnelkgtpiqfaenlswkvd
    ggkliaenpspfymnigeltfggksipshyippkstwafdllagarnvswriindqggld
    rlysknvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ay0B (B:)
    aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
    fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvdvqfainnc
    ikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippk
    stwafdlpkglagarnvswriindqggldrlysknvtl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ay0B (B:)
    vtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplfrldak
    qqnslriaqafprdkeslkwlcvkgippnncikllvrpnelkgtpiqfaenlswkvdggk
    liaenpspfymnigeltfggksipshyippkstwafdlpkglagarnvswriindqggld
    rlysknvtl