PDB entry 4ax1

View 4ax1 on RCSB PDB site
Description: Q157N mutant. Crystal Structure of the Mobile Metallo-beta-Lactamase AIM-1 from Pseudomonas aeruginosa: Insights into Antibiotic Binding and the role of Gln157
Class: hydrolase
Keywords: hydrolase, antibiotic resistance, acquired b3, drug binding site
Deposited on 2012-06-06, released 2012-06-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.13079
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: metallo-beta-lactamase aim-1
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5DCA0
      • engineered mutation (144)
    Domains in SCOPe 2.05: d4ax1b_
  • Heterogens: ZN, CA, MG, ACT, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ax1B (B:)
    mkrrftllgsvvalalsstalasdapasrgcaddagwndpamplkvygntwyvgtcgisa
    llvtsdaghilvdaatpqagpqilaniralgfrpedvraivfshehfdhagslaelqkat
    gapvyarapaidtlkrglpdrtdpnfevaepvapvanivtladdgvvsvgplaltavasp
    ghtpggtswtwrscegddcrqmvyadsltaisddvfrysddaahpgylaafrntlarvaa
    ldcdilvtphpsasglwnrigpraaaplmdttacrryaqgarqrlekrlaeeaatspssg
    arp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ax1B (B:)
    asrgcaddagwndpamplkvygntwyvgtcgisallvtsdaghilvdaatpqagpqilan
    iralgfrpedvraivfshehfdhagslaelqkatgapvyarapaidtlkrglpdrtdpnf
    evaepvapvanivtladdgvvsvgplaltavaspghtpggtswtwrscegddcrqmvyad
    sltaisddvfrysddaahpgylaafrntlarvaaldcdilvtphpsasglwnrigpraaa
    plmdttacrryaqgarqrlekrlaeeaats