PDB entry 4awj

View 4awj on RCSB PDB site
Description: pVHL:EloB:EloC complex, in complex with capped Hydroxyproline
Class: transcription
Keywords: transcription, e3 ubiquitin ligase, tumor supressor
Deposited on 2012-06-04, released 2012-11-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370 (0-End)
• Chain 'B':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15369 (1-96)
• Chain 'C':
  Compound: von hippel-lindau disease tumor suppressor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40337
• Chain 'D':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370 (0-End)
  Domains in SCOPe 2.02: d4awjd_
• Chain 'E':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15369 (1-96)
• Chain 'F':
  Compound: von hippel-lindau disease tumor suppressor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40337
  Domains in SCOPe 2.02: d4awjf_
• Chain 'G':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370 (0-End)
  Domains in SCOPe 2.02: d4awjg_
• Chain 'H':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15369 (1-96)
• Chain 'I':
  Compound: von hippel-lindau disease tumor suppressor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40337
• Chain 'J':
  Compound: Transcription elongation factor B polypeptide 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15370 (0-End)
• Chain 'K':
  Compound: Transcription elongation factor B polypeptide 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15369 (1-96)
    • expression tag (0)
• Chain 'L':
  Compound: von hippel-lindau disease tumor suppressor
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40337
• Heterogens: ACT, V6F, ACY, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >4awjD (D:)
  mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
  gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4awjD (D:)
  mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
  gftsqtarpqapatvglafrdtfealciepfssppelpd
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >4awjF (F:)
  gshmeagrprpvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrih
  syrghlwlfrdagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslv
  kpenyrrldivrslyedledhpnvqkdlerltqeriahqrmgd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4awjF (F:)
  lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
  gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
  slyedledhpnvqkdlerltqe
  

  
  
• Chain 'G':
  Sequence, based on SEQRES records: (download)
  

  >4awjG (G:)
  mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
  gftsqtarpqapatvglafraddtfealciepfssppelpdvmk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4awjG (G:)
  mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
  gftsqtarpqapatvglafraddtfealciepfssppelpdvm
  

  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.