PDB entry 4awi

View 4awi on RCSB PDB site
Description: Human Jnk1alpha kinase with 4-phenyl-7-azaindole IKK2 inhibitor.
Class: transferase
Keywords: transferase
Deposited on 2012-06-03, released 2013-05-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.18769
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 8
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4awia_
  • Heterogens: AQ2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4awiA (A:)
    gplgsmsrskrdnnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaik
    klsrpfqnqthakrayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanl
    cqviqmeldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglart
    agtsfmmtpyvvtryyrapevilgmgykenvdlwsvgcimgemvchkilfpgrdyidqwn
    kvieqlgtpcpefmkklqptvrtyvenrpkyagysfeklfpdvlfpadsehnklkasqar
    dllskmlvidaskrisvdealqhpyinvwydpseaeapppkipdkqlderehtieewkel
    iykevmdle
    

    Sequence, based on observed residues (ATOM records): (download)
    >4awiA (A:)
    nnfysveigdstftvlkryqnlkpigsgaqgivcaaydailernvaikklsrpfqnqtha
    krayrelvlmkcvnhkniigllnvftpqksleefqdvyivmelmdanlcqviqmeldher
    msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglasfmmtpyvvtryyr
    apevilgmgykenvdlwsvgcimgemvchkilfpgrdyidqwnkvieqlgtpcpefmkkl
    qptvrtyvenrpkyagysfeklfpdvlfpadsehnklkasqardllskmlvidaskrisv
    dealqhpyinvwydpseaeapppkipdkqlderehtieewkeliykevmdle