PDB entry 4aw3

View 4aw3 on RCSB PDB site
Description: Structure of the mixed-function P450 MycG F286V mutant in complex with mycinamicin V in P1 space group
Class: oxidoreductase
Keywords: oxidoreductase, mycinamicin biosynthesis
Deposited on 2012-05-30, released 2012-09-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.16934
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59523 (Start-416)
      • engineered mutation (305)
    Domains in SCOPe 2.03: d4aw3a_
  • Chain 'B':
    Compound: p-450-like protein
    Species: Micromonospora griseorubida [TaxId:28040]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59523 (Start-416)
      • engineered mutation (305)
    Domains in SCOPe 2.03: d4aw3b_
  • Heterogens: HEM, MYV, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aw3A (A:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtavpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aw3A (A:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtavpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aw3B (B:)
    mgsshhhhhhssglvprgshmtsaepraypfndvhgltlagrygelqetepvsrvrppyg
    eeawlvtryedvravlgdgrfvrgpsmtrdeprtrpemvkggllsmdppehsrlrrlvvk
    aftarraeslrprareiahelvdqmaatgqpadlvamfarqlpvrvicellgvpsadhdr
    ftrwsgaflstaevtaeemqeaaeqayaymgdlidrrrkeptddlvsalvqardqqdsls
    eqelldlaigllvagyestttqiadfvyllmtrpelrrqlldrpelipsaveeltrwvpl
    gvgtavpryavedvtlrgvtiragepvlastgaanrdqaqfpdadridvdrtpnqhlgfg
    hgvhhclgaplarvelqvalevllqrlpgirlgipetqlrwsegmllrgplelpvvw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aw3B (B:)
    epraypfndvhgltlagrygelqetepvsrvrppygeeawlvtryedvravlgdgrfvrg
    psmtrdeprtrpemvkggllsmdppehsrlrrlvvkaftarraeslrprareiahelvdq
    maatgqpadlvamfarqlpvrvicellgvpsadhdrftrwsgaflstaevtaeemqeaae
    qayaymgdlidrrrkeptddlvsalvqardqqdslseqelldlaigllvagyestttqia
    dfvyllmtrpelrrqlldrpelipsaveeltrwvplgvgtavpryavedvtlrgvtirag
    epvlastgaanrdqaqfpdadridvdrtpnqhlgfghgvhhclgaplarvelqvalevll
    qrlpgirlgipetqlrwsegmllrgplelpvvw