PDB entry 4avs

View 4avs on RCSB PDB site
Description: Structure of N-Acetyl-L-Proline bound to Serum Amyloid P Component
Class: sugar binding protein
Keywords: sugar binding protein, glycoprotein, disulfide bond, lectin, metal-binding
Deposited on 2012-05-29, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4avsa_
  • Chain 'B':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4avsb_
  • Chain 'C':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4avsc_
  • Chain 'D':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4avsd_
  • Chain 'E':
    Compound: serum amyloid p-component
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4avse_
  • Heterogens: NAG, CA, N7P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4avsA (A:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4avsB (B:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4avsC (C:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4avsD (D:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4avsE (E:)
    htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
    llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
    qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
    nildwqalnyeirgyviikplvwv