PDB entry 4ave

View 4ave on RCSB PDB site
Description: C.lacteus nerve Hb in the deoxy form
Class: oxygen transport
Keywords: oxygen transport, nerve globin, heme reactivity, deoxy state, protein matrix tunnel
Deposited on 2012-05-25, released 2013-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neural hemoglobin
  Species: CEREBRATULUS LACTEUS [TaxId:6221]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O76242 (0-109)
  Domains in SCOPe 2.08: d4avea_
• Heterogens: HEM, GOL, SO4, ACT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4aveA (A:)
  mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
  adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl