PDB entry 4av4

View 4av4 on RCSB PDB site
Description: FimH lectin domain co-crystal with a alpha-D-mannoside O-linked to a propynyl pyridine
Class: cell adhesion
Keywords: cell adhesion, fimbriae, variable immunoglobulin fold, urinary tract infection
Deposited on 2012-05-23, released 2012-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FimH
  Species: ESCHERICHIA COLI [TaxId:364106]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A2IC68 (0-157)
    • conflict (36)
  Domains in SCOPe 2.08: d4av4a_
• Heterogens: FVQ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4av4A (A:)
  facktangtaipigggsanvyvnlapvvnvgqnlvvnlstqifchndypetitdyvtlqr
  gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
  kagsliavlilrqtnnynsddfqfvwniyanndvvvpt