PDB entry 4av0

View 4av0 on RCSB PDB site
Description: Structure of the FimH lectin domain in the trigonal space group, in complex with a methoxy phenyl propynyl alpha-D-mannoside at 2.1 A resolution
Class: cell adhesion
Keywords: cell adhesion, bacterial adhesin, type 1 fimbriae, urinary tract infection, variable immunoglobulin fold
Deposited on 2012-05-23, released 2012-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4av0a_
  • Chain 'B':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4av0b_
  • Heterogens: HNV, NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4av0A (A:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4av0B (B:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt