PDB entry 4auy

View 4auy on RCSB PDB site
Description: Structure of the FimH lectin domain in the trigonal space group, in complex with an hydroxyl propynyl phenyl alpha-D-mannoside at 2.1 A resolution
Class: cell adhesion
Keywords: cell adhesion, bacterial adhesin type 1 fimbriae, urinary tract infection, variable immunoglobulin fold
Deposited on 2012-05-22, released 2012-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.1511
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4auya_
  • Chain 'B':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4auyb_
  • Heterogens: HNW, NI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4auyA (A:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4auyB (B:)
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt