PDB entry 4auj

View 4auj on RCSB PDB site
Description: FimH lectin domain co-crystal with a alpha-D-mannoside O-linked to para hydroxypropargyl phenyl
Class: sugar binding protein
Keywords: sugar binding protein, fimbriae, variable immunoglobulin fold, urinary tract infection
Deposited on 2012-05-17, released 2013-05-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.1616
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FimH
  Species: ESCHERICHIA COLI [TaxId:364106]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A2IC68 (0-157)
  Domains in SCOPe 2.06: d4auja_
• Heterogens: HNW, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4aujA (A:)
  facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
  gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
  kagsliavlilrqtnnynsddfqfvwniyanndvvvpt