PDB entry 4aua

View 4aua on RCSB PDB site
Description: Liganded X-ray crystal structure of cyclin dependent kinase 6 (CDK6)
Class: transferase
Keywords: transferase
Deposited on 2012-05-15, released 2013-02-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.21033
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4auaa_
  • Heterogens: 4AU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4auaA (A:)
    mekdglcradqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstir
    evavlrhletfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvpte
    tikdmmfqllrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvv
    vtlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpge
    edwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyf
    qhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4auaA (A:)
    qqyecvaeigegagkvfkardlknggrfvalkrstirevavlrhletfehpnvvrlfdvc
    tkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgldflhshrvvhrdlkpqni
    lvtssgqikladfglatlwyrapevllqssyatpvdlwsvgcifaemfrrkplfrgssdv
    dqlgkildviglpgeedwprdvalprqafhsksaqpiekfvtdidelgkdlllkcltfnp
    akrisaysalshpyfq