PDB entry 4aty

View 4aty on RCSB PDB site
Description: Crystal structure of a Terephthalate 1,2-cis-dihydrodioldehydrogenase from Burkholderia xenovorans LB400
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2012-05-11, released 2012-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: terephthalate 1,2-cis-dihydrodiol dehydrogenase
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4atya_
  • Heterogens: ZN, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4atyA (A:)
    msrtrdramtvalaigdpngigpeiavkaaaqmardersehgghavhsqprivlfgdafv
    irryarqccpelmlrlvqlddlpsaepnaidmvdvaslpaeafvpgevaaaagtatlayv
    saalraaragqvdaviacphsetainasgvrfagypgfvahemgmpaedvyllliggglr
    ivhatlhegiasalarldqrhveraaraavqalqlmgiahpvvglmginphagegglfgr
    ddiditepvarklrddgmtvigpqgadllltnpdidvfvamyhdqghipvklragrhsaa
    lsigagvlfssvghgsgfdiagtlladpapllgairlvttgtvlaplae
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atyA (A:)
    ramtvalaigdpngigpeiavkaaaqmqpivlfgdafvirryarqcclmlrlvpsaidmv
    dvaslpaeafvpgevaaaagtatlayvsaalraaragqvdaviacphsetainasgagyp
    gfvahemgmpaedvyllliggglrivhatlhegiasalarldqrhveraaraavqalqlm
    giahpvvglmginphagegglfgrddiditepvarklrddgmtvigpqgadllltnpdid
    vfvamyhdqghipvklragrhsaalsigagvlfssvghgsgfdiagtlladpapllgair
    lvttgtvla