PDB entry 4att

View 4att on RCSB PDB site
Description: FimH lectin domain co-crystal with a alpha-D-mannoside O-linked to a propynyl para methoxy phenyl
Class: sugar binding protein
Keywords: sugar binding protein, fimbriae, variable immunoglobulin fold, urinary tract infection
Deposited on 2012-05-09, released 2013-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.1511
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:364106]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4atta_
  • Heterogens: HNV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4attA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt