PDB entry 4atp

View 4atp on RCSB PDB site
Description: Structure of GABA-transaminase A1R958 from Arthrobacter aurescens in complex with PLP
Class: transferase
Keywords: transferase
Deposited on 2012-05-09, released 2012-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19512
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpa_
  • Chain 'B':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpb_
  • Chain 'C':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpc_
  • Chain 'D':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpd_
  • Chain 'E':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpe_
  • Chain 'F':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpf_
  • Chain 'G':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpg_
  • Chain 'H':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atph_
  • Chain 'I':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958 (Start-455)
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpi_
  • Chain 'J':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpj_
  • Chain 'K':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpk_
  • Chain 'L':
    Compound: 4-aminobutyrate transaminase
    Species: Arthrobacter aurescens [TaxId:290340]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A1R958
      • see remark 999 (112)
    Domains in SCOPe 2.07: d4atpl_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4atpA (A:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpA (A:)
    syrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfid
    lgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrt
    vlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfape
    vyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegf
    lpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitg
    radlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelaae
    lsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpp
    lvisdellidglevlaaaikah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4atpB (B:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpB (B:)
    lsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfi
    dlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakr
    tvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfap
    evyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaeg
    flpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsait
    gradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelaa
    esvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpp
    lvisdellidglevlaaaikah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4atpC (C:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpC (C:)
    syrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfid
    lgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrt
    vlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfape
    vyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegf
    lpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitg
    radlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelaae
    lsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpp
    lvisdellidglevlaaaikah
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4atpD (D:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpD (D:)
    syrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfid
    lgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrt
    vlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfape
    vyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegf
    lpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitg
    radlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelasv
    vgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpplvi
    sdellidglevlaaaikah
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4atpE (E:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpE (E:)
    lsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfi
    dlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakr
    tvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfap
    evyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaeg
    flpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsait
    gradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelaa
    esvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpp
    lvisdellidglevlaaaikah
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4atpF (F:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpF (F:)
    syrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfid
    lgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrt
    vlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfape
    vyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegf
    lpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitg
    radlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelasv
    vgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpplvi
    sdellidglevlaaaikah
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4atpG (G:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpG (G:)
    syrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfid
    lgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrt
    vlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfape
    vyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegf
    lpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitg
    radlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelaas
    vvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpplv
    isdellidglevlaaaikah
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4atpH (H:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpH (H:)
    syrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfid
    lgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrt
    vlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfape
    vyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegf
    lpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitg
    radlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelaas
    vvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpplv
    isdellidglevlaaaikah
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4atpI (I:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpI (I:)
    yrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfidl
    gsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrtv
    lfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfapev
    yrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegfl
    palsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitgr
    adlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelaaes
    vvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpplv
    isdellidglevlaaaikaha
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4atpJ (J:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpJ (J:)
    yrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfidl
    gsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrtv
    lfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfapev
    yrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegfl
    palsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitgr
    adlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelasvv
    gdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpplvis
    dellidglevlaaaikah
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4atpK (K:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpK (K:)
    syrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfid
    lgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrt
    vlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfape
    vyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegf
    lpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitg
    radlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelasv
    vgdirgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpplvi
    sdellidglevlaaaikah
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4atpL (L:)
    mtttanelsyrieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiird
    vdgnsfidlgsgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrlt
    pgdhakrtvlfnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampykt
    nfgpfapevyrmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgegg
    fivpaegflpalsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagg
    lplsaitgradlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalg
    klrelaaelsagggsvvgdirgrgamlaielvqpgskepnaeltkavaaaclkegviilt
    cgtygnvirllpplvisdellidglevlaaaikaha
    

    Sequence, based on observed residues (ATOM records): (download)
    >4atpL (L:)
    rieqkrningafpgpksqalaerrsavvaagvasgvpvyvedadggiirdvdgnsfidlg
    sgiavtsvgasdpavvaavqeaaahfthtcfmvtpyegyvavteqlnrltpgdhakrtvl
    fnsgaeavenavkvarlatgrdavvafdhayhgrtnltmaltakampyktnfgpfapevy
    rmpmsypfreenpeitgaeaakraitmiekqiggdqvaaiiiepiqgeggfivpaegflp
    alsewakekgivfiadevqsgfcrtgewfavdhegvvpdiitmakgiagglplsaitgra
    dlldavhpgglggtyggnpvacaaalaaidtmeqhdlngrarhieelalgklrelsvvgd
    irgrgamlaielvqpgskepnaeltkavaaaclkegviiltcgtygnvirllpplvisde
    llidglevlaaaikah