PDB entry 4asw

View 4asw on RCSB PDB site
Description: Structure of the complex between the N-terminal dimerisation domain of Sgt2 and the UBL domain of Get5
Class: chaperone
Keywords: chaperone, tail-anchored, post-translational targeting
Deposited on 2012-05-03, released 2013-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small glutamine-rich tetratricopeptide repeat-containing protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12118 (14-91)
      • expression tag (13)
  • Chain 'B':
    Compound: Small glutamine-rich tetratricopeptide repeat-containing protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12118 (14-91)
      • expression tag (13)
  • Chain 'C':
    Compound: ubiquitin-like protein mdy2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4aswc_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >4aswC (C:)
dnaavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdn
lflsdlkvtpanstitvmikpnp

    Sequence, based on observed residues (ATOM records): (download) 
    >4aswC (C:)
naavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnl
flsdlkvtpanstitvmikpn