PDB entry 4ase

View 4ase on RCSB PDB site
Description: crystal structure of vegfr2 (juxtamembrane and kinase domains) in complex with tivozanib (av-951)
Class: transferase
Keywords: transferase, angiogenesis, signaling protein, phosphorylation, receptor, inhibitor
Deposited on 2012-04-30, released 2012-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.207
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vascular endothelial growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4asea_
  • Heterogens: AV9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aseA (A:)
    mgghhhhhhglevlfqgprtvkranggelktgylsivmdpdelpldehcerlpydaskwe
    fprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathsehralmselki
    lihighhlnvvnllgactkpggplmvivefckfgnlstylrskrnefvpykvapedlykd
    fltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfglardiykdpd
    yvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrr
    lkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllqanaqqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aseA (A:)
    dpdelpldehcerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtva
    vkmlkegathsehralmselkilihighhlnvvnllgactkpggplmvivefckfgnlst
    ylrskrnefvpykykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvv
    kicdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslg
    aspypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgn
    llqanaq