PDB entry 4ark

View 4ark on RCSB PDB site
Description: crystal structure of the catalytic domain of human map kinase kinase 1 (mek1) in complex with a small molecule inhibitor and ADP
Class: transferase
Keywords: transferase, kinase, inhibitor
Deposited on 2012-04-24, released 2013-03-06
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.17395
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02750 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.04: d4arka_
  • Heterogens: ADP, MG, M3K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4arkA (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthy
    svqsdiwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssy
    gmdsrppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhaf
    ikrsdaeevdfagwlcstiglnqpstpthaagvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4arkA (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthy
    svqsdiwsmglslvemavgrypipppdakelelmfpmaifelldyivnepppklpsgvfs
    lefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln