PDB entry 4ar4

View 4ar4 on RCSB PDB site
Description: Neutron crystallographic structure of the reduced form perdeuterated Pyrococcus furiosus rubredoxin to 1.38 Angstrom resolution.
Class: electron transport
Keywords: electron transport, perdeuterated, monochromatic neutron crystallography, hydronium, protonation state
Deposited on 2012-04-20, released 2013-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: NEUT
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) [TaxId:186497]
    Gene: RUB, PF1282
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ar4a_
  • Heterogens: FE, D8U, D3O, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ar4A (A:)
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled