PDB entry 4aql

View 4aql on RCSB PDB site
Description: human guanine deaminase in complex with valacyclovir
Class: hydrolase
Keywords: hydrolase, purine metabolism
Deposited on 2012-04-18, released 2012-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.18222
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine deaminase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aqla1, d4aqla2
  • Heterogens: ZN, TXC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aqlA (A:)
    mhhhhhhssgvdlgtenlyfqsmcaaqmpplahifrgtfvhstwtcpmevlrdhllgvsd
    sgkivfleeasqqeklakewcfkpceirelshheffmpglvdthihasqysfagssidlp
    llewltkytfpaehrfqnidfaeevytrvvrrtlkngtttacyfatihtdssllladitd
    kfgqrafvgkvcmdlndtfpeyketteesiketerfvsemlqknysrvkpivtprfslsc
    setlmgelgniaktrdlhiqshisenrdeveavknlypsyknytsvydknnlltnktvma
    hgcylsaeelnvfhergasiahcpnsnlslssgflnvlevlkhevkiglgtdvaggysys
    mldairravmvsnillinkvneksltlkevfrlatlggsqalgldgeignfevgkefdai
    linpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfsssv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aqlA (A:)
    lahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceirel
    shheffmpglvdthihasqysfagssidlpllewltkytfpaehrfqnidfaeevytrvv
    rrtlkngtttacyfatihtdssllladitdkfgqrafvgkvcmdlndtfpeyketteesi
    keterfvsemlqknysrvkpivtprfslscsetlmgelgniaktrdlhiqshisenrdev
    eavknlypsyknytsvydknnlltnktvmahgcylsaeelnvfhergasiahcpnsnlsl
    ssgflnvlevlkhevkiglgtdvaggysysmldairravmvsnillinkvneksltlkev
    frlatlggsqalgldgeignfevgkefdailinpkasdspidlfygdffgdiseaviqkf
    lylgddrnieevyvggkqvvpf