PDB entry 4aqj

View 4aqj on RCSB PDB site
Description: Structure of human S100A7 D24G bound to zinc and calcium
Class: metal binding protein
Keywords: metal binding protein, cancer, inflammation, ef-hand
Deposited on 2012-04-17, released 2012-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.19081
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein s100-a7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31151
      • engineered mutation (29)
      • variant (32)
    Domains in SCOPe 2.06: d4aqja_
  • Heterogens: CA, CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aqjA (A:)
    gsamgmsntqaersiigmidmfhkytrrdgkidkpslltmmkenfpnflsacdkkgtnyl
    advfekkdknedkkidfseflsllgdiatdyhkqshgaapcsggsqaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aqjA (A:)
    sntqaersiigmidmfhkytrrdgkidkpslltmmkenfpnflsacdkkgtnyladvfek
    kdknedkkidfseflsllgdiatdyhkqshgaapcs