PDB entry 4aqi

View 4aqi on RCSB PDB site
Description: Structure of human S100A15 bound to zinc and calcium
Class: metal binding protein
Keywords: metal binding protein, s100, s100-a7a, cancer, inflammation, ef-hand
Deposited on 2012-04-17, released 2012-10-17
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.1997
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein s100-a7a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4aqia_
  • Heterogens: CA, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aqiA (A:)
    gsamgmsntqaersiigmidmfhkytgrdgkiekpslltmmkenfpnflsacdkkgihyl
    atvfekkdknedkkidfseflsllgdiaadyhkqshgaapcsggsqaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aqiA (A:)
    sntqaersiigmidmfhkytgrdgkiekpslltmmkenfpnflsacdkkgihylatvfek
    kdknedkkidfseflsllgdiaadyhkqshgaapcs