PDB entry 4aq6

View 4aq6 on RCSB PDB site
Description: substrate bound homogentisate 1,2-dioxygenase
Class: oxidoreductase
Keywords: oxidoreductase, extradiol-type, extradiol-type dioxygenase
Deposited on 2012-04-12, released 2013-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-14, with a file datestamp of 2013-08-09.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.1639
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6a_
  • Chain 'B':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6b_
  • Chain 'C':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6c_
  • Chain 'D':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6d_
  • Chain 'E':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6e_
  • Chain 'F':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6f_
  • Chain 'G':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6g_
  • Chain 'H':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6h_
  • Chain 'I':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6i_
  • Chain 'J':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6j_
  • Chain 'K':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6k_
  • Chain 'L':
    Compound: homogentisate 1,2-dioxygenase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aq6l_
  • Heterogens: FE, OMD, B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aq6A (A:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6A (A:)
    lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir
    psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag
    vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve
    lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge
    hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman
    mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg
    pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf
    npnrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aq6B (B:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6B (B:)
    lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir
    psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag
    vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve
    lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge
    hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman
    mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg
    pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf
    npnrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4aq6C (C:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6C (C:)
    lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir
    psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag
    vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve
    lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge
    hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman
    mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg
    pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf
    npnrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4aq6D (D:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6D (D:)
    pdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyr
    irpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekp
    agvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfr
    velldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkfl
    gehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgm
    anmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsa
    hgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlps
    tfnpnrr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4aq6E (E:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6E (E:)
    dlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyri
    rpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpa
    gvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrv
    elldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflg
    ehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgma
    nmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsah
    gpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpst
    fnpnrr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4aq6F (F:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6F (F:)
    lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir
    psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag
    vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve
    lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge
    hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman
    mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg
    pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf
    npnrr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4aq6G (G:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6G (G:)
    lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir
    psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag
    vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve
    lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge
    hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman
    mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg
    pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf
    npnrr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4aq6H (H:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6H (H:)
    lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir
    psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag
    vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve
    lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge
    hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman
    mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg
    pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf
    npnrr
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4aq6I (I:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6I (I:)
    dlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyri
    rpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpa
    gvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrv
    elldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflg
    ehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgma
    nmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsah
    gpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpst
    fnpnrr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4aq6J (J:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6J (J:)
    lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir
    psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag
    vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve
    lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge
    hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman
    mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg
    pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf
    npnrr
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4aq6K (K:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6K (K:)
    dlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyri
    rpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpa
    gvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrv
    elldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflg
    ehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgma
    nmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsah
    gpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpst
    fnpnrr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4aq6L (L:)
    mnrdtspdlhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselr
    rtwlyrirpsalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaan
    agaekpagvsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiavip
    rgmkfrvelldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvq
    lvqkflgehwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsp
    tsvhgmanmdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggasl
    hgvmsahgpdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydsc
    watlpstfnpnrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aq6L (L:)
    lhylsgfgnefasealpgalpvgqnspqkapyglyaellsgtaftmarselrrtwlyrir
    psalhprferlarqplggplgginpnrlrwspqpipaeptdfiegwlpmaanagaekpag
    vsiyiyranrsmervffnadgelllvpeqgrlriatelgvmevepleiaviprgmkfrve
    lldgqargyiaenhgaplrlpdlgpigsnglanprdfltpvahyeeaegpvqlvqkflge
    hwacelqhspldvvawhgsnvpykydlrrfntigtvsfdhpdpsiftvltsptsvhgman
    mdfvifpprwmvaentfrppwfhrnlmnefmglingaydakaegflpggaslhgvmsahg
    pdaetcekaiaadlaphkidntmafmfetsqvlrpslqalecpqlqadydscwatlpstf
    npnrr