PDB entry 4apz

View 4apz on RCSB PDB site
Description: Structure of B. subtilis genomic dUTPase YncF in complex with dU, PPi and Mg in P1
Class: hydrolase
Keywords: hydrolase, yncf
Deposited on 2012-04-11, released 2013-04-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.17122
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apz1_
  • Chain '2':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apz2_
  • Chain '3':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apz3_
  • Chain '4':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apz4_
  • Chain '5':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apz5_
  • Chain '6':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apz6_
  • Chain '7':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apz7_
  • Chain '8':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apz8_
  • Chain '9':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apz9_
  • Chain 'A':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apza_
  • Chain 'B':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzb_
  • Chain 'C':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzc_
  • Chain 'D':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzd_
  • Chain 'E':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apze_
  • Chain 'F':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzf_
  • Chain 'G':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzg_
  • Chain 'H':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzh_
  • Chain 'I':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzi_
  • Chain 'J':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzj_
  • Chain 'K':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzk_
  • Chain 'L':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzl_
  • Chain 'M':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzm_
  • Chain 'N':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzn_
  • Chain 'O':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzo_
  • Chain 'P':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzp_
  • Chain 'Q':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzq_
  • Chain 'R':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzr_
  • Chain 'S':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzs_
  • Chain 'T':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzt_
  • Chain 'U':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzu_
  • Chain 'V':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzv_
  • Chain 'W':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzw_
  • Chain 'X':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzx_
  • Chain 'Y':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzy_
  • Chain 'Z':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4apzz_
  • Chain 'a':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'c':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'd':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'f':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'g':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'i':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'l':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DUR, POP, MG, PO4, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >4apz1 (1:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apz1 (1:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >4apz2 (2:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apz2 (2:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >4apz3 (3:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apz3 (3:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >4apz4 (4:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apz4 (4:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >4apz5 (5:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apz5 (5:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >4apz6 (6:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apz6 (6:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >4apz7 (7:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apz7 (7:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >4apz8 (8:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apz8 (8:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >4apz9 (9:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apz9 (9:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4apzA (A:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzA (A:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehlgnedrgglgstgtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4apzB (B:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzB (B:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4apzC (C:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzC (C:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4apzD (D:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzD (D:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4apzE (E:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzE (E:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4apzF (F:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzF (F:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehlgnedrgglgstgtk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4apzG (G:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzG (G:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4apzH (H:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzH (H:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4apzI (I:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzI (I:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4apzJ (J:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzJ (J:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4apzK (K:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzK (K:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4apzL (L:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzL (L:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4apzM (M:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzM (M:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4apzN (N:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzN (N:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4apzO (O:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzO (O:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4apzP (P:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzP (P:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4apzQ (Q:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzQ (Q:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehlgnedrgglgstgtk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4apzR (R:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzR (R:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4apzS (S:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzS (S:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4apzT (T:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzT (T:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4apzU (U:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzU (U:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4apzV (V:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzV (V:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4apzW (W:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzW (W:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4apzX (X:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzX (X:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4apzY (Y:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzY (Y:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >4apzZ (Z:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4apzZ (Z:)
    mqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvp
    rsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpav
    elvevehlgnedrgglgstgtk
    

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    No sequence available.

  • Chain 'c':
    No sequence available.

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    No sequence available.

  • Chain 'f':
    No sequence available.

  • Chain 'g':
    No sequence available.

  • Chain 'h':
    No sequence available.

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    No sequence available.

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.