PDB entry 4apr

View 4apr on RCSB PDB site
Description: structures of complexes of rhizopuspepsin with pepstatin and other statine-containing inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: ACID PROTEINASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1989-08-03, released 1991-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: rhizopuspepsin
    Species: Rhizopus chinensis [TaxId:4843]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06026 (0-323)
      • conflict (14)
      • conflict (53)
      • conflict (60)
      • conflict (115)
      • conflict (161)
      • conflict (229)
      • conflict (255)
      • conflict (280)
      • conflict (293-294)
    Domains in SCOPe 2.08: d4apre_
  • Chain 'I':
    Compound: pepstatin-like renin inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 4APR
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4aprE (E:)
    agvgtvpmtdygndieyygqvtigtpgkkfnldfdtgssdlwiastlctncgsgqtkydp
    nqsstyqadgrtwsisygdgssasgilakdnvnlggllikgqtielakreaasfasgpnd
    gllglgfdtittvrgvktpmdnlisqglisrpifgvylgkaknggggeyifggydstkfk
    gslttvpidnsrgwwgitvdratvgtstvassfdgildtgttllilpnniaasvarayga
    sdngdgtytiscdtsafkplvfsingasfqvspdslvfeefqgqciagfgygnwgfaiig
    dtflknnyvvfnqgvpevqiapvae
    

  • Chain 'I':
    No sequence available.