PDB entry 4ap7

View 4ap7 on RCSB PDB site
Description: Crystal structure of C-MET kinase domain in complex with 4-((6-(4- fluorophenyl)-(1,2,4)triazolo(4,3-b)(1,2,4)triazin-3-yl)methyl)phenol
Class: transferase
Keywords: transferase
Deposited on 2012-03-30, released 2012-09-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4ap7a_
  • Heterogens: F47, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ap7A (A:)
    mvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
    ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
    fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehh
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ap7A (A:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkkihcavkslnri
    tdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethn
    ptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyy
    svhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvy
    llqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi