PDB entry 4aoz

View 4aoz on RCSB PDB site
Description: B. subtilis dUTPase YncF in complex with dU, PPi and Mg (P212121)
Class: hydrolase
Keywords: hydrolase
Deposited on 2012-03-30, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.16169
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aoza_
  • Chain 'B':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aozb_
  • Chain 'C':
    Compound: probable deoxyuridine 5'-triphosphate nucleotidohydrolase yncf
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4aozc_
  • Heterogens: DUR, POP, MG, ACT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aozA (A:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aozA (A:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aozB (B:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aozB (B:)
    tmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahvv
    prsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpa
    velvevehlgnedrgglgstgtk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4aozC (C:)
    mtmqikikyldetqtriskieqgdwidlraaedvtikkdefklvplgvamelpegyeahv
    vprsstyknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmp
    avelvevehlgnedrgglgstgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aozC (C:)
    tmqikikyldetqtrieqgdwidlraaedvtikkdefklvplgvamelpegyeahvvprs
    styknfgviqtnsmgvidesykgdndfwffpayalrdteikkgdricqfrimkkmpavel
    vevehlgnedrgglgstgtk