PDB entry 4aot

View 4aot on RCSB PDB site
Description: Crystal Structure of Human Serine Threonine Kinase-10 (LOK) Bound to GW830263A
Class: transferase
Keywords: transferase, stk10, lok
Deposited on 2012-03-29, released 2012-04-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.21877
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94804 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4aota_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94804 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d4aotb_
  • Heterogens: CL, GW8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aotA (A:)
    smrksreyehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeel
    edyiveieilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiq
    vvcrqmlealnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigt
    pywmapevvmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpp
    tlltpskwsvefrdflkialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevm
    ee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aotA (A:)
    smrksreyehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeel
    edyiveieilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiq
    vvcrqmlealnflhskriihrdlkagnvlmtlegdirladfgvsagtpywmapevvmydy
    kadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdflkiald
    knpetrpsaaqllehpfvssitsnkalrelvaeakaev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4aotB (B:)
    smrksreyehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeel
    edyiveieilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiq
    vvcrqmlealnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigt
    pywmapevvmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpp
    tlltpskwsvefrdflkialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevm
    ee
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aotB (B:)
    smrksreyehvrrdpnevweivgelgdgafgkvykaknketgalaaakvietkseeeled
    yiveieilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvv
    crqmlealnflhskriihrdlkagnvlmtlegdirladfgvsakigtpywmapevvmpyd
    ykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdflkial
    dknpetrpsaaqllehpfvssitsnkalrelvaeakaev