PDB entry 4aop

View 4aop on RCSB PDB site
Description: sulfite reductase hemoprotein partially photoreduced with proflavine edta, phosphate partially bound
Deposited on 1997-07-09, released 1998-01-14
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >4aop_ (-)
    lrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsvg
    ldalatandmnrnvlctsnpyesqlhaeayewakkisehllprtrayaeiwldqekvatt
    deepilgqtylprkfkttvvippqndidlhandmnfvaiaengklvgfnllvggglsieh
    gnkktyartasefgylplehtlavaeavvttqrdwgnrtdrknaktkytlervgvetfka
    everragikfepirpyeftgrgdrigwvkgiddnwhltlfiengrildyparplktglle
    iakihkgdfritanqnliiagvpesekakiekiakesglmnavtpqrensmacvsfptcp
    lamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgramlaevglvgkapgry
    nlhlggnrigtriprmykenitepeilasldeligrwakereagegfgdftvragiirpv
    ldpardlwd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aop_ (-)
    lrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilpvhqmlhsvgldaln
    dmnrnvlctsnpyesqlhaeayewakkisehllplprkfkttvvippqndidlhandmnf
    vaiaengklvgfnllvggglsiehgnkktyartasefgylplehtlavaeavvttqrdwg
    nrtdrknaktkytlervgvetfkaeverragikfepirpyeftgrgdrigwvkgiddnwh
    ltlfiengrildyparplktglleiakihkgdfritanqnliiagvpesekakiekiake
    sglmnavtpqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvt
    gcpngcgramlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligr
    wakereagegfgdftvragiirpvldpardlwd