PDB entry 4aoh

View 4aoh on RCSB PDB site
Description: Structural snapshots and functional analysis of human angiogenin variants associated with Amyotrophic Lateral Sclerosis (ALS)
Class: hydrolase
Keywords: hydrolase, angiogenesis, neovascularisation, amyotropic lateral sclerosis, als, motor neuron disease, ribonuclease inhibitor, nuclear localisation, nuclear localization
Deposited on 2012-03-27, released 2012-10-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-11-28, with a file datestamp of 2012-11-23.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: 0.1698
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4aoha_
  • Heterogens: TAR, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4aohA (A:)
    aqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicen
    kngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsi
    frrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4aohA (A:)
    aqdnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicen
    kngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsi
    frr