PDB entry 4aog

View 4aog on RCSB PDB site
Description: Solution structure of the Class II hydrophobin NC2
Class: structural protein
Keywords: structural protein, surface active protein
Deposited on 2012-03-26, released 2013-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nc2
  Species: NEUROSPORA CRASSA [TaxId:367110]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7S3P5 (1-79)
    • cloning artifact (0)
  Domains in SCOPe 2.08: d4aoga1, d4aoga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4aogA (A:)
  spaamerqvpytpcsglygtaqccatdvlgvadldcanppatlanathfestcaaigqra
  rccvlpilgqdilcqtpagl