PDB entry 4anm

View 4anm on RCSB PDB site
Description: Complex of CK2 with a CDC7 inhibitor
Class: transferase
Keywords: transferase
Deposited on 2012-03-20, released 2012-05-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.16636
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28523 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.06: d4anma1, d4anma2
  • Heterogens: WUL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4anmA (A:)
    gsskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnek
    ciikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvl
    yptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhp
    gkeynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvk
    iakvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkl
    lrydhqerltaleamthpyfqqvraaensrtraef
    

    Sequence, based on observed residues (ATOM records): (download)
    >4anmA (A:)
    sskarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekc
    iikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvly
    ptltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpg
    keynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvki
    akvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkll
    rydhqerltaleamthpyfqqvraaens