PDB entry 4anj

View 4anj on RCSB PDB site
Description: MYOSIN VI (MDinsert2-GFP fusion) PRE-POWERSTROKE STATE (MG.ADP.AlF4)
Class: motor protein/metal-bindng protein
Keywords: motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state, pre-powerstroke state, gfp fusion
Deposited on 2012-03-19, released 2012-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unconventional myosin-vi, green fluorescent protein
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29122 (Start-815)
      • see remark 999 (546)
      • see remark 999 (571-572)
      • see remark 999 (713)
      • see remark 999 (720-721)
      • engineered mutation (880)
      • chromophore (880)
    • Uniprot P42212 (817-End)
  • Chain 'B':
    Compound: calmodulin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4anjb_
  • Heterogens: ADP, MG, ALF, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4anjB (B:)
    madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltde
    evdemireadidgdgqvnyeefvtmmtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4anjB (B:)
    teeqiaefkeafslfdkdgdgtelgtvmrslgqnpteaelqdminevdadgngtidfpef
    ltmmarkdseeeireafrvfdkdgngfisaaelrhvmttdeevdemireadidgdgqvny
    eefvtmmt