PDB entry 4an1

View 4an1 on RCSB PDB site
Description: prolyl oligopeptidase from porcine brain with a covalently bound inhibitor ic-4
Class: hydrolase
Keywords: alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase
Deposited on 2012-03-14, released 2012-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4an1a1, d4an1a2
  • Heterogens: 2P8, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4an1A (A:)
    mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
    glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
    ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
    dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
    sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
    tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
    lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
    vfrevtvkgidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisi
    tpnysvsrlifvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylike
    gytspkrltinggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdyg
    csdskqhfewlikysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyiv
    grsrkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnidwip